WWW.ROBTEX.COM - d2rw1bqtgmrxu2.cloudfront.net
Search for IP or hostnames:
d2rw1bqtgmrxu2.cloudfront.net checked at 2025-11-22T07:40:33.593Z 3153ms 231/231/231 100% R:13 allDone:true timedOut:false d2rw1bqtgmrxu2.cloudfront.net
cloudfront.net
| NS | ns-418.awsdns-52.com | ||||||
| NS | ns-666.awsdns-19.net | ||||||
| NS | ns-1306.awsdns-35.org | ||||||
| NS | ns-1597.awsdns-07.co.uk | ||||||
rank #6 in the tld
This domain, "cloudfront.net", is owned by Amazon Web Services (AWS) and is used for their content delivery network (CDN) service, CloudFront. The service speeds up the distribution of static and dynamic web content, such as .html, .css, .js, and image files, to users. CloudFront delivers the content through a worldwide network of data centers called edge locations, ensuring high availability and performance.
Starts with same word
d2rw1bqtgmrxu2.cloudfront.net |
Starts similarily
d2rw1bqtgmrxu2.cloudfront.net |
AI analysis
d2rw1bqtgmrxu2.cloudfront.net points to twelve IP numbers: 2600:9000:28a0:1600:18:b612:8280:93a1, 2600:9000:28a0:4c00:18:b612:8280:93a1, 2600:9000:28a0:5000:18:b612:8280:93a1, 2600:9000:28a0:7c00:18:b612:8280:93a1, 2600:9000:28a0:8c00:18:b612:8280:93a1, 2600:9000:28a0:9c00:18:b612:8280:93a1, 2600:9000:28a0:c000:18:b612:8280:93a1, 2600:9000:28a0:de00:18:b612:8280:93a1, 3.171.38.21, 3.171.38.39, 3.171.38.81 and 3.171.38.112.
other host names for instance uwp.academia.edu, clcclskj.academia.edu, oakwood.academia.edu, immrc.academia.edu and rrcc.academia.edu share IP numbers with d2rw1bqtgmrxu2.cloudfront.net.
d2rw1bqtgmrxu2.cloudfront.net is delegated to four name servers: ns-505.awsdns-63.com, ns-881.awsdns-46.net, ns-1123.awsdns-12.org and ns-1924.awsdns-48.co.uk.
d2rw1bqtgmrxu2.cloudfront.net at least partially shares name servers with other domains, for instance test-iq.gr, franklinpharmacyandhealthcare.com, mym.com, instadate.mobi and istyle.mk.
These name servers are commonly used with ns-327.awsdns-40.com, ns-1330.awsdns-38.org, ns-806.awsdns-36.net, ns-718.awsdns-25.net, ns-1228.awsdns-25.org, ns-1898.awsdns-45.co.uk and ns-685.awsdns-21.net.
Host names with two IP numbers:
Host name ns-505.awsdns-63.com points to: 2600:9000:5301:f900::1 and 205.251.193.249.
Host name ns-881.awsdns-46.net points to: 2600:9000:5303:7100::1 and 205.251.195.113.
Host name ns-1123.awsdns-12.org points to: 2600:9000:5304:6300::1 and 205.251.196.99.
Host name ns-1924.awsdns-48.co.uk points to: 2600:9000:5307:8400::1 and 205.251.199.132.